OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PDSS2 (NM_020381) Human Mass Spec Standard

Be the first to review this product
SKU
PH307892
PDSS2 MS Standard C13 and N15-labeled recombinant protein (NP_065114)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA503951 PDSS2 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12) 100 ul
$447.00
LY412512 Transient overexpression lysate of prenyl (decaprenyl) diphosphate synthase, subunit 2 (PDSS2) (as WB positive control) 100 ug
$436.00

Other products for "PDSS2 or NM_020381"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207892
Predicted MW 44.2 kDa
Protein Sequence
Protein Sequence
>RC207892 protein sequence
Red=Cloning site Green=Tags(s)

MNFRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIVGYPTSFMSLR
CLLSDELSNIAMQVRKLVGTQHPLLTTARGLVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNYDMVSG
IYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKDMQFGNKIAILSGDFLLANACNGLALLQNTK
VVELLASALMDLVQGVYHENSTSKESYITDDIGISTWKEQTFLSHGALLAKSCQAAMELAKHDAEVQNMA
FQYGKHMAMSHKINSDVQPFIKEKTSDSMTFNLNSAPVVLHQEFLGRDLWIKQIREAQEKGRLDYAKLRE
RIKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065114
RefSeq Size 3568
RefSeq ORF 1197
Synonyms bA59I9.3; C6orf210; COQ1B; COQ10D3; DLP1; hDLP1
Locus ID 57107
UniProt ID Q86YH6
Cytogenetics 6q21
Summary The protein encoded by this gene is an enzyme that synthesizes the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. The gene product catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. Defects in this gene are a cause of coenzyme Q10 deficiency.provided by RefSeq, Oct 2009
Protein Pathways Terpenoid backbone biosynthesis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PDSS2" proteins (3)
SKU Description Size Price
LC412512 Lyophilized PDSS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412512 Transient overexpression lysate of prenyl (decaprenyl) diphosphate synthase, subunit 2 (PDSS2) (as WB positive control) 100 ug
$436.00
TP307892 Recombinant protein of human prenyl (decaprenyl) diphosphate synthase, subunit 2 (PDSS2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products