NSUN6 (NM_182543) Human Mass Spec Standard

SKU
PH307817
NSUN6 MS Standard C13 and N15-labeled recombinant protein (NP_872349)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207817]
Predicted MW 51.8 kDa
Protein Sequence
Protein Sequence
>RC207817 protein sequence
Red=Cloning site Green=Tags(s)

MSIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPSFTTVRVNTHLASVQHVKNL
LLDELQKQFNGLSVPILQHPDLQDVLLIPVIGPRKNIKKQQCEAIVGAQCGNAVLRGAHVYAPGIVSASQ
FMKAGDVISVYSDIKGKCKKGAKEFDGTKVFLGNGISELSRKEIFSGLPELKGMGIRMTEPVYLSPSFDS
VLPRYLFLQNLPSALVSHVLNPQPGEKILDLCAAPGGKTTHIAALMHDQGEVIALDKIFNKVEKIKQNAL
LLGLNSIRAFCFDGTKAVKLDMVEDTEGEPPFLPESFDRILLDAPCSGMGQRPNMACTWSVKEVASYQPL
QRKLFTAAVQLLKPEGVLVYSTCTITLAENEEQVAWALTKFPCLQLQPQEPQIGGEGMRGAGLSCEQLKQ
LQRFDPSAVPLPDTDMDSLREARREDMLRLANKDSIGFFIAKFVKCKST

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_872349
RefSeq Size 2570
RefSeq ORF 1407
Synonyms 4933414E04Rik; ARL5B-AS1; NOPD1
Locus ID 221078
UniProt ID Q8TEA1
Cytogenetics 10p12.31
Summary May have S-adenosyl-L-methionine-dependent methyl-transferase activity.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:NSUN6 (NM_182543) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405497 NSUN6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405497 Transient overexpression lysate of NOP2/Sun domain family, member 6 (NSUN6) 100 ug
$436.00
TP307817 Recombinant protein of human NOL1/NOP2/Sun domain family, member 6 (NSUN6), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.