Interferon regulatory factor 9 (IRF9) (NM_006084) Human Mass Spec Standard

SKU
PH307768
IRF9 MS Standard C13 and N15-labeled recombinant protein (NP_006075)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207768]
Predicted MW 43.7 kDa
Protein Sequence
Protein Sequence
>RC207768 protein sequence
Red=Cloning site Green=Tags(s)

MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYK
EGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSS
ERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEF
LLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGIL
VASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLN
FWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006075
RefSeq Size 1699
RefSeq ORF 1179
Synonyms IRF-9; ISGF3; ISGF3G; p48
Locus ID 10379
UniProt ID Q00978
Cytogenetics 14q12
Summary This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Mutations in this gene result in Immunodeficiency 65. [provided by RefSeq, Jul 2020]
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Jak-STAT signaling pathway
Write Your Own Review
You're reviewing:Interferon regulatory factor 9 (IRF9) (NM_006084) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401832 IRF9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401832 Transient overexpression lysate of interferon regulatory factor 9 (IRF9) 100 ug
$436.00
TP307768 Recombinant protein of human interferon regulatory factor 9 (IRF9), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.