NAB1 (NM_005966) Human Mass Spec Standard

SKU
PH307767
NAB1 MS Standard C13 and N15-labeled recombinant protein (NP_005957)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207767]
Predicted MW 54.4 kDa
Protein Sequence
Protein Sequence
>RC207767 protein sequence
Red=Cloning site Green=Tags(s)

MAAALPRTLGELQLYRILQKANLLSYFDAFIQQGGDDVQQLCEAGEEEFLEIMALVGMASKPLHVRRLQK
ALRDWVTNPGLFNQPLTSLPVSSIPIYKLPEGSPTWLGISCSSYERSSNAREPHLKIPKCAATTCVQSLG
QGKSDVVGSLALQSVGESRLWQGHHATESEHSLSPADLGSPASPKESSEALDAAAALSVAECVERMAPTL
PKSDLNEVKELLKTNKKLAKMIGHIFEMNDDDPHKEEEIRKYSAIYGRFDSKRKDGKHLTLHELTVNEAA
AQLCVKDNALLTRRDELFALARQISREVTYKYTYRTTKSKCGERDELSPKRIKVEDGFPDFQDSVQTLFQ
QARAKSEELAALSSQQPEKVMAKQMEFLCNQAGYERLQHAERRLSAGLYRQSSEEHSPNGLTSDNSDGQG
ERPLNLRMPNLQNRQPHHFVVDGELSRLYPSEAKSHSSESLGILKDYPHSAFTLEKKVIKTEPEDSR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005957
RefSeq Size 4499
RefSeq ORF 1461
Locus ID 4664
UniProt ID Q13506
Cytogenetics 2q32.2
Summary Acts as a transcriptional repressor for zinc finger transcription factors EGR1 and EGR2.[UniProtKB/Swiss-Prot Function]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:NAB1 (NM_005966) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401805 NAB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401805 Transient overexpression lysate of NGFI-A binding protein 1 (EGR1 binding protein 1) (NAB1) 100 ug
$436.00
TP307767 Recombinant protein of human NGFI-A binding protein 1 (EGR1 binding protein 1) (NAB1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.