H963 (GPR171) (NM_013308) Human Mass Spec Standard

SKU
PH307757
GPR171 MS Standard C13 and N15-labeled recombinant protein (NP_037440)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207757]
Predicted MW 36.7 kDa
Protein Sequence
Protein Sequence
>RC207757 protein sequence
Red=Cloning site Green=Tags(s)

MTNSSFFCPVYKDLEPFTYFFYLVFLVGIIGSCFATWAFIQKNTNHRCVSIYLINLLTADFLLTLALPVK
IVVDLGVAPWKLKIFHCQVTACLIYINMYLSIIFLAFVSIDRCLQLTHSCKIYRIQEPGFAKMISTVVWL
MVLLIMVPNMMIPIKDIKEKSNVGCMEFKKEFGRNWHLLTNFICVAIFLNFSAIILISNCLVIRQLYRNK
DNENYPNVKKALINILLVTTGYIICFVPYHIVRIPYTLSQTEVITDCSTRISLFKAKEATLLLAVSNLCF
DPVLYYHLSKAFRSKVTETFASPKETKAQKEKLRCENNA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037440
RefSeq Size 1862
RefSeq ORF 957
Synonyms H963
Locus ID 29909
UniProt ID O14626
Cytogenetics 3q25.1
Summary Orphan receptor.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, GPCR, Transmembrane
Write Your Own Review
You're reviewing:H963 (GPR171) (NM_013308) Human Mass Spec Standard
Your Rating
SKU Description Size Price
TP307757 Recombinant protein of human G protein-coupled receptor 171 (GPR171), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.