AHSP (NM_016633) Human Mass Spec Standard

SKU PH307743

AHSP MS Standard C13 and N15-labeled recombinant protein (NP_057717)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC207743]
• Predicted MW: 11.8 kDa
• Protein Sequence:
  Protein Sequence

  >RC207743 protein sequence; Red=Cloning site Green=Tags(s); ; MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQEL; RQELNTLANPFLAKYRDFLKSHELPSHPPPSS; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_057717
• RefSeq Size: 518
• RefSeq ORF: 306
• Synonyms: EDRF; ERAF
• Locus ID: 51327
• UniProt ID: Q9NZD4
• Cytogenetics: 16p11.2
• Summary: This gene encodes a molecular chaperone which binds specifically to free alpha-globin and is involved in hemoglobin assembly. The encoded protein binds to monomeric alpha-globin until it has been transferred to beta-globin to form a heterodimer, which in turn binds to another heterodimer to form the stable tetrameric hemoglobin. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]