MAST4 (NM_198828) Human Mass Spec Standard

SKU
PH307706
MAST4 MS Standard C13 and N15-labeled recombinant protein (NP_942123)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207706]
Predicted MW 25.5 kDa
Protein Sequence
Protein Sequence
>RC207706 representing NM_198828
Red=Cloning site Green=Tags(s)

MGEKVSEAPEPVPRGCSGHGSRTPASALVAASSPGASSAESSSGSETLSEEGEPGGFSREHQPPPPPPLG
GTLGARAPAAWAPASVLLERGVLALPPPLPGGAVPPAPRGSSASQEEQDEELDHILSPPPMPFRKCSNPD
VASGPGKSLKYKRQLSEDGRQLRRGSLGGALTGRYLLPNPVAGQAWPASAETSNLVRMRSQALGQSAPSL
TASLKELSLPRRGSLIDSQKWNCLVKRPVCPNAGRTSPLG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_942123
RefSeq Size 1105
RefSeq ORF 750
Locus ID 375449
UniProt ID O15021
Cytogenetics 5q12.3
Summary This gene encodes a member of the microtubule-associated serine/threonine protein kinases. The proteins in this family contain a domain that gives the kinase the ability to determine its own scaffold to control the effects of their kinase activities. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2014]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:MAST4 (NM_198828) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC404775 MAST4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404775 Transient overexpression lysate of microtubule associated serine/threonine kinase family member 4 (MAST4), transcript variant 2 100 ug
$436.00
TP307706 Recombinant protein of human microtubule associated serine/threonine kinase family member 4 (MAST4), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.