DNAJC8 (NM_014280) Human Mass Spec Standard

SKU
PH307697
DNAJC8 MS Standard C13 and N15-labeled recombinant protein (NP_055095)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207697]
Predicted MW 29.7 kDa
Protein Sequence
Protein Sequence
>RC207697 representing NM_014280
Red=Cloning site Green=Tags(s)

MAASGESGTSGGGGSTEEAFMTFYSEVKQIEKRDSVLTSKNQIERLTRPGSSYFNLNPFEVLQIDPEVTD
EEIKKRFRQLSILVHPDKNQDDADRAQKAFEAVDKAYKLLLDQEQKKRALDVIQAGKEYVEHTVKERKKQ
LKKEGKPTIVEEDDPELFKQAVYKQTMKLFAELEIKRKEREAKEMHERKRQREEEIEAQEKAKREREWQK
NFEESRDGRVDSWRNFQANTKGKKEKKNRTFLRPPKVKMEQRE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055095
RefSeq Size 1765
RefSeq ORF 759
Synonyms HSPC331; SPF31
Locus ID 22826
UniProt ID O75937
Cytogenetics 1p35.3
Summary Suppresses polyglutamine (polyQ) aggregation of ATXN3 in neuronal cells (PubMed:27133716).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:DNAJC8 (NM_014280) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415384 DNAJC8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415384 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 8 (DNAJC8) 100 ug
$436.00
TP307697 Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 8 (DNAJC8), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.