AGXT2L2 (PHYKPL) (NM_153373) Human Mass Spec Standard

SKU
PH307667
AGXT2L2 MS Standard C13 and N15-labeled recombinant protein (NP_699204)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207667]
Predicted MW 49.7 kDa
Protein Sequence
Protein Sequence
>RC207667 protein sequence
Red=Cloning site Green=Tags(s)

MAADQRPKADTLALRQRLISSSCRLFFPEDPVKIVRAQGQYMYDEQGAEYIDCISNVAHVGHCHPLVVQA
AHEQNQVLNTNSRYLHDNIVDYAQRLSETLPEQLCVFYFLNSGSEANDLALRLARHYTGHQDVVVLDHAY
HGHLSSLIDISPYKFRNLDGQKEWVHVAPLPDTYRGPYREDHPNPAMAYANEVKRVVSSAQEKGRKIAAF
FAESLPSVGGQIIPPAGYFSQVAEHIRKAGGVFVADEIQVGFGRVGKHFWAFQLQGKDFVPDIVTMGKSI
GNGHPVACVAATQPVARAFEATGVEYFNTFGGSPVSCAVGLAVLNVLEKEQLQDHATSVGSFLMQLLGQQ
KIKHPIVGDVRGVGLFIGVDLIKDEATRTPATEEAAYLVSRLKENYVLLSTDGPGRNILKFKPPMCFSLD
NARQVVAKLDAILTDMEEKVRSCETLRLQP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_699204
RefSeq Size 2098
RefSeq ORF 1350
Synonyms AGXT2L2; PHLU
Locus ID 85007
UniProt ID Q8IUZ5
Cytogenetics 5q35.3
Summary This is a nuclear gene encoding a mitochondrial enzyme that catalyzes the conversion of 5-phosphonooxy-L-lysine to ammonia, inorganic phosphate, and 2-aminoadipate semialdehyde. Mutations in this gene may cause phosphohydroxylysinuria. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:AGXT2L2 (PHYKPL) (NM_153373) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407084 PHYKPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407084 Transient overexpression lysate of alanine-glyoxylate aminotransferase 2-like 2 (AGXT2L2) 100 ug
$436.00
TP307667 Recombinant protein of human alanine-glyoxylate aminotransferase 2-like 2 (AGXT2L2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.