C4orf33 (NM_173487) Human Mass Spec Standard

SKU
PH307633
C4orf33 MS Standard C13 and N15-labeled recombinant protein (NP_775758)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207633]
Predicted MW 23.4 kDa
Protein Sequence
Protein Sequence
>RC207633 protein sequence
Red=Cloning site Green=Tags(s)

MDFKIEHTWDGFPVKHEPVFIRLNPGDRGVMMDISAPFFRDPPAPLGEPGKPFNELWDYEVVEAFFLNDI
TEQYLEVELCPHGQHLVLLLSGRRNVWKQELPLSFRVSRGETKWEGKAYLPWSYFPPNVTKFNSFAIHGS
KDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFNTLLGEEWKQPESDLWLIEKCDI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_775758
RefSeq Size 1873
RefSeq ORF 597
Locus ID 132321
UniProt ID Q8N1A6
Cytogenetics 4q28.2
Write Your Own Review
You're reviewing:C4orf33 (NM_173487) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH316543 C4orf33 MS Standard C13 and N15-labeled recombinant protein (NP_001093253) 10 ug
$3,255.00
LC406603 C4orf33 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420533 C4orf33 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406603 Transient overexpression lysate of chromosome 4 open reading frame 33 (C4orf33), transcript variant 1 100 ug
$436.00
LY420533 Transient overexpression lysate of chromosome 4 open reading frame 33 (C4orf33), transcript variant 2 100 ug
$436.00
TP307633 Recombinant protein of human chromosome 4 open reading frame 33 (C4orf33), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP316543 Recombinant protein of human chromosome 4 open reading frame 33 (C4orf33), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.