OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TFF1 (NM_003225) Human Mass Spec Standard

Be the first to review this product
SKU
PH307599
TFF1 MS Standard C13 and N15-labeled recombinant protein (NP_003216)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA804522 TFF1 mouse monoclonal antibody,clone OTI7B12 100 ul
$447.00
LY418822 Transient overexpression lysate of trefoil factor 1 (TFF1) (as WB positive control) 100 ug
$436.00

Other products for "TFF1 or NM_003225"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207599
Predicted MW 9.15 kDa
Protein Sequence
Protein Sequence
>RC207599 representing NM_003225
Red=Cloning site Green=Tags(s)

MATMENKVICALVLVSMLALGTLAEAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFY
PNTIDVPPEEECEF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003216
RefSeq Size 508
RefSeq ORF 252
Synonyms BCEI; D21S21; HP1.A; HPS2; pNR-2; pS2
Locus ID 7031
UniProt ID P04155
Cytogenetics 21q22.3
Summary Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer, and affect healing of the epithelium. This gene, which is expressed in the gastric mucosa, has also been studied because of its expression in human tumors. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TFF1" proteins (3)
SKU Description Size Price
LC418822 Lyophilized TFF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418822 Transient overexpression lysate of trefoil factor 1 (TFF1) (as WB positive control) 100 ug
$436.00
TP307599 Purified recombinant protein of Homo sapiens trefoil factor 1 (TFF1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products