TFF1 (NM_003225) Human Mass Spec Standard

SKU PH307599

TFF1 MS Standard C13 and N15-labeled recombinant protein (NP_003216)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC207599]
• Predicted MW: 9.15 kDa
• Protein Sequence:
  Protein Sequence

  >RC207599 representing NM_003225; Red=Cloning site Green=Tags(s); ; MATMENKVICALVLVSMLALGTLAEAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFY; PNTIDVPPEEECEF; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_003216
• RefSeq Size: 508
• RefSeq ORF: 252
• Synonyms: BCEI; D21S21; HP1.A; HPS2; pNR-2; pS2
• Locus ID: 7031
• UniProt ID: P04155
• Cytogenetics: 21q22.3
• Summary: Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer, and affect healing of the epithelium. This gene, which is expressed in the gastric mucosa, has also been studied because of its expression in human tumors. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Secreted Protein