TULP3 (NM_003324) Human Mass Spec Standard

SKU
PH307595
TULP3 MS Standard C13 and N15-labeled recombinant protein (NP_003315)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207595]
Predicted MW 49.7 kDa
Protein Sequence
Protein Sequence
>RC207595 protein sequence
Red=Cloning site Green=Tags(s)

MEASRCRLSPSGDSVFHEEMMKMRQAKLDYQRLLLEKRQRKKRLEPFMVQPNPEARLRRAKPRASDEQTP
LVNCHTPHSNVILHGIDGPAAVLKPDEVHAPSVSSSVVEEDAENTVDTASKPGLQERLQKHDISESVNFD
EETDGISQSACLERPNSASSQNSTDTGTSGSATAAQPADNLLGDIDYLEDFVYSPAPQGVTVRCRIIRDK
RGMDRGLFPTYYMYLEKEENQKIFLLAARKRKKSKTANYLISIDPVDLSREGESYVGKLRSNLMGTKFTV
YDRGICPMKGRGLVGAAHTRQELAAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLLSRW
QNRTMENLVELHNKAPVWNSDTQSYVLNFRGRVTQASVKNFQIVHKNDPDYIVMQFGRVADDVFTLDYNY
PLCAVQAFGIGLSSFDSKLACE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003315
RefSeq Size 3106
RefSeq ORF 1326
Synonyms TUBL3
Locus ID 7289
UniProt ID O75386
Cytogenetics 12p13.33
Summary This gene encodes a member of the tubby gene family of bipartite transcription factors. Members of this family have been identified in plants, vertebrates, and invertebrates, and they share a conserved N-terminal transcription activation region and a conserved C-terminal DNA and phosphatidylinositol-phosphate binding region. The encoded protein binds to phosphoinositides in the plasma membrane via its C-terminal region and probably functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis, for instance, induced by G-protein-coupled-receptor signaling. It plays an important role in neuronal development and function. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, May 2009]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:TULP3 (NM_003324) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418767 TULP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431443 TULP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418767 Transient overexpression lysate of tubby like protein 3 (TULP3), transcript variant 1 100 ug
$436.00
LY431443 Transient overexpression lysate of tubby like protein 3 (TULP3), transcript variant 2 100 ug
$436.00
TP307595 Recombinant protein of human tubby like protein 3 (TULP3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.