ZFP200 (ZNF200) (NM_003454) Human Mass Spec Standard

SKU
PH307594
ZNF200 MS Standard C13 and N15-labeled recombinant protein (NP_003445)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207594]
Predicted MW 45.5 kDa
Protein Sequence
Protein Sequence
>RC207594 protein sequence
Red=Cloning site Green=Tags(s)

MMAAKVVPMPPKPKQSFILRVPPDSKLGQDLLRDATNGPKTIHQLVLEHFLTFLPKPSLVQPSQKVKETL
VIMKDVSSSLQNRVHPRPLVKLLPKGVQKEQETVSLYLKANPEELVVFEDLNVFHCQEECVSLDPTQQLT
SEKEDDSSVGEMMLLAVNGSNPEGEDPEREPVENEDYREKSSDDDEMDSSLVSQQPPDNQEKERLNTSIP
QKRKMRNLLVTIENDTPLEELSKYVDISIIALTRNRRTRRWYTCPLCGKQFNESSYLISHQRTHTGEKPY
DCNHCGKSFNHKTNLNKHERIHTGEKPYSCSQCGKNFRQNSHRSRHEGIHIREKIFKCPECGKTFPKNEE
FVLHLQSHEAERPYGCKKCGRRFGRLSNCTRHEKTHSACKTRKQK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003445
RefSeq Size 3387
RefSeq ORF 1185
Locus ID 7752
UniProt ID P98182
Cytogenetics 16p13.3
Summary Could have a role in spermatogenesis.[UniProtKB/Swiss-Prot Function]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:ZFP200 (ZNF200) (NM_003454) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405074 ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405075 ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418671 ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428893 ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428894 ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428895 ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405074 Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 3 100 ug
$436.00
LY405075 Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 2 100 ug
$436.00
LY418671 Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 1 100 ug
$436.00
LY428893 Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 4 100 ug
$436.00
LY428894 Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 5 100 ug
$436.00
LY428895 Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 6 100 ug
$436.00
TP307594 Recombinant protein of human zinc finger protein 200 (ZNF200), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP760180 Recombinant protein of human zinc finger protein 200 (ZNF200), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00
TP760732 Purified recombinant protein of Human zinc finger protein 200 (ZNF200), transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.