RNF41 (NM_194358) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC207568] |
Predicted MW | 35.9 kDa |
Protein Sequence |
Protein Sequence
>RC207568 protein sequence
Red=Cloning site Green=Tags(s) MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVVTVAHLRPVPR IMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGCGLEMPKDELPNHNCIKHLRS VVQQQQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEETIEYNEILEWVNSLQPAR VTRWGGMISTPDAVLQAVIKRSLVESGCPASIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRI PGKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVEEI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_919339 |
RefSeq Size | 5420 |
RefSeq ORF | 951 |
Synonyms | FLRF; NRDP1; SBBI03 |
Locus ID | 10193 |
UniProt ID | Q9H4P4 |
Cytogenetics | 12q13.3 |
Summary | This gene encodes an E3 ubiquitin ligase. The encoded protein plays a role in type 1 cytokine receptor signaling by controlling the balance between JAK2-associated cytokine receptor degradation and ectodomain shedding. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2011] |
Protein Pathways | Endocytosis |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC405109 | RNF41 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC405110 | RNF41 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC417072 | RNF41 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY405109 | Transient overexpression lysate of ring finger protein 41 (RNF41), transcript variant 2 | 100 ug |
$436.00
|
|
LY405110 | Transient overexpression lysate of ring finger protein 41 (RNF41), transcript variant 3 | 100 ug |
$436.00
|
|
LY417072 | Transient overexpression lysate of ring finger protein 41 (RNF41), transcript variant 1 | 100 ug |
$436.00
|
|
TP307568 | Recombinant protein of human ring finger protein 41 (RNF41), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP760790 | Purified recombinant protein of Human ring finger protein 41 (RNF41), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.