RNF41 (NM_194358) Human Mass Spec Standard

SKU
PH307568
RNF41 MS Standard C13 and N15-labeled recombinant protein (NP_919339)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207568]
Predicted MW 35.9 kDa
Protein Sequence
Protein Sequence
>RC207568 protein sequence
Red=Cloning site Green=Tags(s)

MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVVTVAHLRPVPR
IMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGCGLEMPKDELPNHNCIKHLRS
VVQQQQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEETIEYNEILEWVNSLQPAR
VTRWGGMISTPDAVLQAVIKRSLVESGCPASIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRI
PGKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVEEI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_919339
RefSeq Size 5420
RefSeq ORF 951
Synonyms FLRF; NRDP1; SBBI03
Locus ID 10193
UniProt ID Q9H4P4
Cytogenetics 12q13.3
Summary This gene encodes an E3 ubiquitin ligase. The encoded protein plays a role in type 1 cytokine receptor signaling by controlling the balance between JAK2-associated cytokine receptor degradation and ectodomain shedding. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2011]
Protein Pathways Endocytosis
Write Your Own Review
You're reviewing:RNF41 (NM_194358) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405109 RNF41 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405110 RNF41 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417072 RNF41 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405109 Transient overexpression lysate of ring finger protein 41 (RNF41), transcript variant 2 100 ug
$436.00
LY405110 Transient overexpression lysate of ring finger protein 41 (RNF41), transcript variant 3 100 ug
$436.00
LY417072 Transient overexpression lysate of ring finger protein 41 (RNF41), transcript variant 1 100 ug
$436.00
TP307568 Recombinant protein of human ring finger protein 41 (RNF41), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP760790 Purified recombinant protein of Human ring finger protein 41 (RNF41), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.