PNK (PNKP) (NM_007254) Human Mass Spec Standard

SKU
PH307551
PNKP MS Standard C13 and N15-labeled recombinant protein (NP_009185)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207551]
Predicted MW 57.1 kDa
Protein Sequence
Protein Sequence
>RC207551 protein sequence
Red=Cloning site Green=Tags(s)

MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQVELVADPETRTVAVKQLGVN
PSTTGTQELKPGLEGSLGVGDTLYLVNGLHPLTLRWEETRTPESQPDTPPGTPLVSQDEKRDAELPKKRM
RKSNPGWENLEKLLVFTAAGVKPQGKVAGFDLDGTLITTRSGKVFPTGPSDWRILYPEIPRKLRELEAEG
YKLVIFTNQMSIGRGKLPAEEFKAKVEAVVEKLGVPFQVLVATHAGLYRKPVTGMWDHLQEQANDGTPIS
IGDSIFVGDAAGRPANWAPGRKKKDFSCADRLFALNLGLPFATPEEFFLKWPAAGFELPAFDPRTVSRSG
PLCLPESRALLSASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLGSWQRCVTTCETALKQGKRVA
IDNTNPDAASRARYVQCARAAGVPCRCFLFTATLEQARHNNRFREMTDSSHIPVSDMVMYGYRKQFEAPT
LAEGFSAILEIPFRLWVEPRLGRLYCQFSEG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009185
RefSeq Size 1721
RefSeq ORF 1563
Synonyms AOA4; CMT2B2; EIEE10; MCSZ; PNK
Locus ID 11284
UniProt ID Q96T60
Cytogenetics 19q13.33
Summary This locus represents a gene involved in DNA repair. In response to ionizing radiation or oxidative damage, the protein encoded by this locus catalyzes 5' phosphorylation and 3' dephosphorylation of nucleic acids. Mutations at this locus have been associated with microcephaly, seizures, and developmental delay.[provided by RefSeq, Sep 2010]
Protein Families Druggable Genome, Phosphatase
Write Your Own Review
You're reviewing:PNK (PNKP) (NM_007254) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416093 PNKP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416093 Transient overexpression lysate of polynucleotide kinase 3'-phosphatase (PNKP) 100 ug
$436.00
TP307551 Recombinant protein of human polynucleotide kinase 3'-phosphatase (PNKP), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.