DDAH1 (NM_012137) Human Mass Spec Standard

SKU
PH307548
DDAH1 MS Standard C13 and N15-labeled recombinant protein (NP_036269)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207548]
Predicted MW 31.1 kDa
Protein Sequence
Protein Sequence
>RC207548 protein sequence
Red=Cloning site Green=Tags(s)

MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADES
LPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFV
GLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYD
KLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLIN
KKVDS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036269
RefSeq Size 3991
RefSeq ORF 855
Synonyms DDAH; DDAH-1; DDAHI; HEL-S-16
Locus ID 23576
UniProt ID O94760
Cytogenetics 1p22.3
Summary This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:DDAH1 (NM_012137) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402166 DDAH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427443 DDAH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402166 Transient overexpression lysate of dimethylarginine dimethylaminohydrolase 1 (DDAH1), transcript variant 1 100 ug
$436.00
LY427443 Transient overexpression lysate of dimethylarginine dimethylaminohydrolase 1 (DDAH1), transcript variant 2 100 ug
$436.00
TP307548 Recombinant protein of human dimethylarginine dimethylaminohydrolase 1 (DDAH1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.