CNOT4 (NM_001008225) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC207541] |
Predicted MW | 63.1 kDa |
Protein Sequence |
Protein Sequence
>RC207541 protein sequence
Red=Cloning site Green=Tags(s) MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPL SQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHK VVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDC MYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQSPIDKPSDSL SIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDIFRHPNPIPSGLPP FPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKEL SVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPG QAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHSLQQ GQQPTSLHTTVA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001008226 |
RefSeq Size | 3774 |
RefSeq ORF | 1716 |
Synonyms | CLONE243; NOT4; NOT4H |
Locus ID | 4850 |
UniProt ID | O95628 |
Cytogenetics | 7q33 |
Summary | The protein encoded by this gene is a subunit of the CCR4-NOT complex, a global transcriptional regulator. The encoded protein interacts with CNOT1 and has E3 ubiquitin ligase activity. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2010] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | RNA degradation |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC415669 | CNOT4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC423402 | CNOT4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC434319 | CNOT4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY415669 | Transient overexpression lysate of CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 1 | 100 ug |
$665.00
|
|
LY423402 | Transient overexpression lysate of CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 2 | 100 ug |
$436.00
|
|
LY434319 | Transient overexpression lysate of CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 4 | 100 ug |
$436.00
|
|
TP307541 | Recombinant protein of human CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP762054 | Purified recombinant protein of Human CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 1,Leu190-Ala455, with N-terminal His tag, expressed in E. coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.