BST2 (NM_004335) Human Mass Spec Standard

SKU PH307540

BST2 MS Standard C13 and N15-labeled recombinant protein (NP_004326)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC207540]
• Predicted MW: 19.8 kDa
• Protein Sequence:
  Protein Sequence

  >RC207540 protein sequence; Red=Cloning site Green=Tags(s); ; MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLL; QQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRE; NQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ; ; SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_004326
• RefSeq Size: 1048
• RefSeq ORF: 540
• Synonyms: CD317; HM1.24; TETHERIN
• Locus ID: 684
• UniProt ID: Q10589
• Cytogenetics: 19p13.11
• Summary: Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transmembrane