BLU (ZMYND10) (NM_015896) Human Mass Spec Standard

SKU
PH307521
ZMYND10 MS Standard C13 and N15-labeled recombinant protein (NP_056980)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207521]
Predicted MW 50.3 kDa
Protein Sequence
Protein Sequence
>RC207521 protein sequence
Red=Cloning site Green=Tags(s)

MGDLELLLPGEAEVLVRGLRSFPLREMGSEGWNQQHENLEKLNMQAILDATVSQGEPIQELLVTHGKVPT
LVEELIAVEMWKQKVFPVFCRVEDFKPQNTFPIYMVVHHEASIINLLETVFFHKEVCESAEDTVLDLVDY
CHRKLTLLVAQSGCGGPPEGEGSQDSNPMQELQKQAELMEFEIALKALSVLRYITDCVDSLSLSTLSRML
STHNLPCLLVELLEHSPWSRREGGKLQQFEGSRWHTVAPSEQQKLSKLDGQVWIALYNLLLSPEAQARYC
LTSFAKGRLLKLRAFLTDTLLDQLPNLAHLQSFLAHLTLTETQPPKKDLVLEQIPEIWERLERENRGKWQ
AIAKHQLQHVFSPSEQDLRLQARRWAETYRLDVLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQV
KHWEKHGKTCVLAAQGDRAK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056980
RefSeq Size 1780
RefSeq ORF 1320
Synonyms BLU; CILD22; DNAAF7; FLU
Locus ID 51364
UniProt ID O75800
Cytogenetics 3p21.31
Summary This gene encodes a protein containing a MYND-type zinc finger domain that likely functions in assembly of the dynein motor. Mutations in this gene can cause primary ciliary dyskinesia. This gene is also considered a tumor suppressor gene and is often mutated, deleted, or hypermethylated and silenced in cancer cells. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015]
Write Your Own Review
You're reviewing:BLU (ZMYND10) (NM_015896) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414328 ZMYND10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414328 Transient overexpression lysate of zinc finger, MYND-type containing 10 (ZMYND10) 100 ug
$436.00
TP307521 Recombinant protein of human zinc finger, MYND-type containing 10 (ZMYND10), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.