Activin Receptor Type IA (ACVR1) (NM_001105) Human Mass Spec Standard

SKU
PH307486
ACVR1 MS Standard C13 and N15-labeled recombinant protein (NP_001096)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207486]
Predicted MW 57.15 kDa
Protein Sequence
Protein Sequence
>RC207486 representing NM_001105
Red=Cloning site Green=Tags(s)

MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGC
FQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLAC
LLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITL
LECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLW
LITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQC
CIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVS
NGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALR
IKKTLTKIDNSLDKLKTDC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001096
RefSeq Size 2952
RefSeq ORF 1527
Synonyms ACTRI; ACVR1A; ACVRLK2; ALK2; FOP; SKR1; TSRI
Locus ID 90
UniProt ID Q04771
Cytogenetics 2q24.1
Summary Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I ( I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors. Mutations in this gene are associated with fibrodysplasia ossificans progressive. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, TGF-beta signaling pathway
Write Your Own Review
You're reviewing:Activin Receptor Type IA (ACVR1) (NM_001105) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH325877 ACVR1 MS Standard C13 and N15-labeled recombinant protein (NP_001104537) 10 ug
$3,255.00
LC420209 ACVR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426349 ACVR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY420209 Transient overexpression lysate of activin A receptor, type I (ACVR1), transcript variant 1 100 ug
$436.00
LY426349 Transient overexpression lysate of activin A receptor, type I (ACVR1), transcript variant 2 100 ug
$436.00
TP307486 Recombinant protein of human activin A receptor, type I (ACVR1), transcript variant 1, 20 µg 20 ug
$737.00
TP325877 Recombinant protein of human activin A receptor, type I (ACVR1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.