SNX16 (NM_152836) Human Mass Spec Standard

SKU
PH307476
SNX16 MS Standard C13 and N15-labeled recombinant protein (NP_690049)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207476]
Predicted MW 39.2 kDa
Protein Sequence
Protein Sequence
>RC207476 protein sequence
Red=Cloning site Green=Tags(s)

MATPYVPVPMPIGNSASSFTTNRNQRSSSFGSVSTSSNSSKGQLEDSNMGNFKQTSVPDQMDNTSSVCSS
PLIRTKFTGTASSIEYSTRPRDTEEQNPETVNWEDRPSTPTILGYEVMEERAKFTVYKILVKKTPEESWV
VFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREF
LCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSLEPE
ESLDVSETEGEQILKVESSALEVDQDVLDEESRADNKPCLSFSEPENAVSEIEVAEVAYDAEED

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_690049
RefSeq Size 3225
RefSeq ORF 1032
Locus ID 64089
UniProt ID P57768
Cytogenetics 8q21.13
Summary This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. The protein encoded by this gene associates with late endosome membranes as is involved in tubule formation, cholesterol transport, and transport of tetraspanin CD81. The encoded protein also inhibits cell migration and tumorigenesis. [provided by RefSeq, Jan 2017]
Write Your Own Review
You're reviewing:SNX16 (NM_152836) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH316565 SNX16 MS Standard C13 and N15-labeled recombinant protein (NP_071416) 10 ug
$3,255.00
LC403494 SNX16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC411753 SNX16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403494 Transient overexpression lysate of sorting nexin 16 (SNX16), transcript variant 2 100 ug
$436.00
LY411753 Transient overexpression lysate of sorting nexin 16 (SNX16), transcript variant 1 100 ug
$436.00
TP307476 Recombinant protein of human sorting nexin 16 (SNX16), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP316565 Recombinant protein of human sorting nexin 16 (SNX16), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.