C10orf88 (NM_024942) Human Mass Spec Standard

SKU
PH307467
C10orf88 MS Standard C13 and N15-labeled recombinant protein (NP_079218)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207467]
Predicted MW 49.2 kDa
Protein Sequence
Protein Sequence
>RC207467 protein sequence
Red=Cloning site Green=Tags(s)

METRTEDGGLTRRPTLASSWDVAGGALTHSLLLTRAGLGPGDFDWEELLAPPAPGQDLVILKRNHNNKDE
NPCFLYLRCGPDGGEEIASIGILSSARNMEVYLGEEYCGTSRGKNVCTVLDDSEHEKIILYKKNLKLESS
THACKIKLLSFGERQCVFISKVVVHMRSVFANSSTSSPALGSRIDLDKVQTIMESMGSKLSPGAQQLMDM
VRCQQRNCIPIGEQLQSVLGNSGYKHMIGLQSSSTLGTLNKSSSTPFPFRTGLTSGNVTENLQTYIDKST
QLPGGENSTKLDECKVMPQNHSFLENDLKNAMASFLPKKVSDNSNIPNSELLPFLQNLCSQVNHLHVGNK
TECQENITKHGERILGVGMEEQSICSYLEKILSKNMELMEKKLMDYIDQRIHELQEHIDDKIALLLDLLQ
NPNSPPTGIPLRHYDSGERLSNGER

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079218
RefSeq Size 3102
RefSeq ORF 1335
Synonyms PAAT
Locus ID 80007
UniProt ID Q9H8K7
Cytogenetics 10q26.13
Summary ATPase that regulates mitochondrial ABC transporters ABCB7, ABCB8/MITOSUR and ABCB10 (PubMed:25063848). Regulates mitochondrial ferric concentration and heme biosynthesis and plays a role in the maintenance of mitochondrial homeostasis and cell survival (PubMed:25063848).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:C10orf88 (NM_024942) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410974 C10orf88 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410974 Transient overexpression lysate of chromosome 10 open reading frame 88 (C10orf88) 100 ug
$436.00
TP307467 Recombinant protein of human chromosome 10 open reading frame 88 (C10orf88), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.