Glutathione Peroxidase 7 (GPX7) (NM_015696) Human Mass Spec Standard

SKU
PH307428
GPX7 MS Standard C13 and N15-labeled recombinant protein (NP_056511)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207428]
Predicted MW 21 kDa
Protein Sequence
Protein Sequence
>RC207428 protein sequence
Red=Cloning site Green=Tags(s)

MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQL
QRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEP
TWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056511
RefSeq Size 1246
RefSeq ORF 561
Synonyms CL683; GPx-7; GPX6; GSHPx-7; NPGPx
Locus ID 2882
UniProt ID Q96SL4
Cytogenetics 1p32.3
Summary It protects esophageal epithelia from hydrogen peroxide-induced oxidative stress. It suppresses acidic bile acid-induced reactive oxigen species (ROS) and protects against oxidative DNA damage and double-strand breaks.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Arachidonic acid metabolism, Glutathione metabolism
Write Your Own Review
You're reviewing:Glutathione Peroxidase 7 (GPX7) (NM_015696) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414390 GPX7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414390 Transient overexpression lysate of glutathione peroxidase 7 (GPX7) 100 ug
$436.00
TP307428 Recombinant protein of human glutathione peroxidase 7 (GPX7), 20 µg 20 ug
$737.00
TP701060 Purified recombinant protein of Human glutathione peroxidase 7 (GPX7), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.