KPNA3 (NM_002267) Human Mass Spec Standard

SKU
PH307314
KPNA3 MS Standard C13 and N15-labeled recombinant protein (NP_002258)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207314]
Predicted MW 57.9 kDa
Protein Sequence
Protein Sequence
>RC207314 protein sequence
Red=Cloning site Green=Tags(s)

MAENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDVDADFKAQN
VTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVKCLERDDNPSLQFEAAWALT
NIASGTSAQTQDIVQSNAVPLFLRLLRSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISP
SIPITFLRNVTWVIVNLCRNKDPPPPMETVQEILPALCVLIYHTDINILVDTVWALSYLTDGGNEQIQMV
IDSGVVPFLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDVLSHFQNLLSHPKEKINKEAVWFL
SNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQDVIPPFCNLL
SVKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDI
DEDPCLIPEATQGGTYNFDPTANLQTKEFNF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002258
RefSeq Size 4478
RefSeq ORF 1563
Synonyms hSRP1; IPOA4; SRP1; SRP1gamma; SRP4
Locus ID 3839
UniProt ID O00505
Cytogenetics 13q14.2
Summary The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import. [provided by RefSeq, Jan 2009]
Write Your Own Review
You're reviewing:KPNA3 (NM_002267) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400821 KPNA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400821 Transient overexpression lysate of karyopherin alpha 3 (importin alpha 4) (KPNA3) 100 ug
$436.00
TP307314 Recombinant protein of human karyopherin alpha 3 (importin alpha 4) (KPNA3), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.