OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KPNA3 (NM_002267) Human Mass Spec Standard

Be the first to review this product
SKU
PH307314
KPNA3 MS Standard C13 and N15-labeled recombinant protein (NP_002258)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA377888 KPNA3 Rabbit polyclonal Antibody
100 ul
$410.00
LY400821 Transient overexpression lysate of karyopherin alpha 3 (importin alpha 4) (KPNA3) (as WB positive control) 100 ug
$436.00

Other products for "KPNA3 or NM_002267"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207314
Predicted MW 57.9 kDa
Protein Sequence
Protein Sequence
>RC207314 protein sequence
Red=Cloning site Green=Tags(s)

MAENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDVDADFKAQN
VTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVKCLERDDNPSLQFEAAWALT
NIASGTSAQTQDIVQSNAVPLFLRLLRSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISP
SIPITFLRNVTWVIVNLCRNKDPPPPMETVQEILPALCVLIYHTDINILVDTVWALSYLTDGGNEQIQMV
IDSGVVPFLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDVLSHFQNLLSHPKEKINKEAVWFL
SNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQDVIPPFCNLL
SVKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDI
DEDPCLIPEATQGGTYNFDPTANLQTKEFNF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002258
RefSeq Size 4478
RefSeq ORF 1563
Synonyms hSRP1; IPOA4; SRP1; SRP1gamma; SRP4
Locus ID 3839
UniProt ID O00505
Cytogenetics 13q14.2
Summary The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import. provided by RefSeq, Jan 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "KPNA3" proteins (3)
SKU Description Size Price
LC400821 Lyophilized KPNA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400821 Transient overexpression lysate of karyopherin alpha 3 (importin alpha 4) (KPNA3) (as WB positive control) 100 ug
$436.00
TP307314 Recombinant protein of human karyopherin alpha 3 (importin alpha 4) (KPNA3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products