PPIL6 (NM_173672) Human Mass Spec Standard

SKU
PH307244
PPIL6 MS Standard C13 and N15-labeled recombinant protein (NP_775943)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207244]
Predicted MW 35.2 kDa
Protein Sequence
Protein Sequence
>RC207244 protein sequence
Red=Cloning site Green=Tags(s)

MARPQPCGPPHARCGSPSLPERPLQVKVVGLFSCPNFQIAKSAAENLKNNHPSKFEDPILVPLQEFAWHQ
YLQEKKRELKNETWEYSSSVISFVNGQFLGDALDLQKWAHEVWDIVDIKPSALYDALTEDFSAKFLRDTK
HDFVFLDICIDSSPIGRLIFELYCDVCPKTCKNFQVLCTGKAGFSQRGIRLHYKNSIFHRIVQNGWIQGG
DIVYGKGDNGESIYGPTFEDENFSVPHNKRGVLGMANKGRHSNGSQFYITLQATPYLDRKFVAFGQLIEG
TEVLKQLELVPTQNERPIHMCRITDSGDPYA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_775943
RefSeq Size 4145
RefSeq ORF 933
Synonyms bA425D10.6; dJ919F19.1; PPIase; RSPH12
Locus ID 285755
UniProt ID Q8IXY8
Cytogenetics 6q21
Summary Probable inactive PPIase with no peptidyl-prolyl cis-trans isomerase activity.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PPIL6 (NM_173672) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406551 PPIL6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426361 PPIL6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406551 Transient overexpression lysate of peptidylprolyl isomerase (cyclophilin)-like 6 (PPIL6), transcript variant 1 100 ug
$436.00
LY426361 Transient overexpression lysate of peptidylprolyl isomerase (cyclophilin)-like 6 (PPIL6), transcript variant 2 100 ug
$436.00
TP307244 Recombinant protein of human peptidylprolyl isomerase (cyclophilin)-like 6 (PPIL6), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.