DTD1 (NM_080820) Human Mass Spec Standard

SKU PH307233

DTD1 MS Standard C13 and N15-labeled recombinant protein (NP_543010)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC207233]
• Predicted MW: 23.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC207233 protein sequence; Red=Cloning site Green=Tags(s); ; MKAVVQRVTRASVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDK; QYEILCVSQFTLQCVLKGNKPDFNLAMPTEQAEGFYNSFLEQLRKTYRPELIKDGKFGAYMQVHIQNDGP; VTIELESPAPGTATSDPKQLSKLEKQQQRKEKTRAKGPSESSKERNTPRKEDRSASSGAEGDVSSEREP; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_543010
• RefSeq Size: 1368
• RefSeq ORF: 627
• Synonyms: C20orf88; DTD; DUE-B; DUEB; HARS2; pqn-68
• Locus ID: 92675
• UniProt ID: Q8TEA8
• Cytogenetics: 20p11.23
• Summary: The protein encoded by this gene is similar in sequence to histidyl-tRNA synthetase, which hydrolyzes D-tyrosyl-tRNA(Tyr) into D-tyrosine and free tRNA(Tyr). The encoded protein binds the DNA unwinding element and plays a role in the initiation of DNA replication. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]