TSSK2 (NM_053006) Human Mass Spec Standard

SKU
PH307232
TSSK2 MS Standard C13 and N15-labeled recombinant protein (NP_443732)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207232]
Predicted MW 41 kDa
Protein Sequence
Protein Sequence
>RC207232 protein sequence
Red=Cloning site Green=Tags(s)

MDDATVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPREMDILATVNHG
SIIKTYEIFETSDGRIYIIMELGVQGDLLEFIKCQGALHEDVARKMFRQLSSAVKYCHDLDIVHRDLKCE
NLLLDKDFNIKLSDFGFSKRCLRDSNGRIILSKTFCGSAAYAAPEVLQSIPYQPKVYDIWSLGVILYIMV
CGSMPYDDSDIRKMLRIQKEHRVDFPRSKNLTCECKDLIYRMLQPDVSQRLHIDEILSHSWLQPPKPKAT
SSASFKREGEGKYRAECKLDTKTDLRPDHRPDHKLGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISG
AEVGKAST

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_443732
RefSeq Size 1832
RefSeq ORF 1074
Synonyms DGS-G; SPOGA2; STK22B; TSK2
Locus ID 23617
UniProt ID Q96PF2
Cytogenetics 22q11.21
Summary TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).[supplied by OMIM, Mar 2008]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:TSSK2 (NM_053006) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403278 TSSK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403278 Transient overexpression lysate of testis-specific serine kinase 2 (TSSK2) 100 ug
$436.00
TP307232 Recombinant protein of human testis-specific serine kinase 2 (TSSK2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.