TMEFF1 (NM_003692) Human Mass Spec Standard

SKU
PH307212
TMEFF1 MS Standard C13 and N15-labeled recombinant protein (NP_003683)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207212]
Predicted MW 40.9 kDa
Protein Sequence
Protein Sequence
>RC207212 protein sequence
Red=Cloning site Green=Tags(s)

MGAAAAEAPLRLPAAPPLAFCCYTSVLLLFAFSLPGSRASNQPPGGGGGSGGDCPGGKGKSINCSELNVR
ESDVRVCDESSCKYGGVCKEDGDGLKCACQFQCHTNYIPVCGSNGDTYQNECFLRRAACKHQKEITVIAR
GPCYSDNGSGSGEGEEEGSGAEVHRKHSKCGPCKYKAECDEDAENVGCVCNIDCSGYSFNPVCASDGSSY
NNPCFVREASCIKQEQIDIRHLGHCTDTDDTSLLGKKDDGLQYRPDVKDASDQREDVYIGNHMPCPENLN
GYCIHGKCEFIYSTQKASCRCESGYTGQHCEKTDFSILYVVPSRQKLTHVLIAAIIGAVQIAIIVAIVMC
ITRKCPKNNRGRRQKQNLGHFTSDTSSRMV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003683
RefSeq Size 2501
RefSeq ORF 1140
Synonyms C9orf2; CT120.1; H7365; TR-1
Locus ID 8577
UniProt ID Q8IYR6
Cytogenetics 9q31.1
Summary May inhibit NODAL and BMP signaling during neural patterning (By similarity). May be a tumor suppressor in brain cancers.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:TMEFF1 (NM_003692) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401231 TMEFF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401231 Transient overexpression lysate of transmembrane protein with EGF-like and two follistatin-like domains 1 (TMEFF1) 100 ug
$436.00
TP307212 Purified recombinant protein of Homo sapiens transmembrane protein with EGF-like and two follistatin-like domains 1 (TMEFF1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.