EAF1 (NM_033083) Human Mass Spec Standard

SKU
PH307169
EAF1 MS Standard C13 and N15-labeled recombinant protein (NP_149074)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207169]
Predicted MW 29 kDa
Protein Sequence
Protein Sequence
>RC207169 protein sequence
Red=Cloning site Green=Tags(s)

MNGTANPLLDREEHCLRLGESFEKRPRASFHTIRYDFKPASIDTSCEGELQVGKGDEVTITLPHIPGSTP
PMTVFKGNKRPYQKDCVLIINHDTGEFVLEKLSSSIQVKKTRAEGSSKIQARMEQQPTRPPQTSQPPPPP
PPMPFRAPTKPPVGPKTSPLKDNPSPEPQLDDIKRELRAEVDIIEQMSSSSGSSSSDSESSSGSDDDSSS
SGGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSNQLMNALRNDLQLSESGSDSDD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_149074
RefSeq Size 4503
RefSeq ORF 804
Locus ID 85403
UniProt ID Q96JC9
Cytogenetics 3p25.1
Summary Acts as a transcriptional transactivator of ELL and ELL2 elongation activities.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:EAF1 (NM_033083) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409733 EAF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409733 Transient overexpression lysate of ELL associated factor 1 (EAF1) 100 ug
$436.00
TP307169 Purified recombinant protein of Homo sapiens ELL associated factor 1 (EAF1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.