OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EAF1 (NM_033083) Human Mass Spec Standard

Be the first to review this product
SKU
PH307169
EAF1 MS Standard C13 and N15-labeled recombinant protein (NP_149074)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA375688 EAF1 Rabbit polyclonal Antibody
100 ul
$410.00
LY409733 Transient overexpression lysate of ELL associated factor 1 (EAF1) (as WB positive control) 100 ug
$436.00

Other products for "EAF1 or NM_033083"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207169
Predicted MW 29 kDa
Protein Sequence
Protein Sequence
>RC207169 protein sequence
Red=Cloning site Green=Tags(s)

MNGTANPLLDREEHCLRLGESFEKRPRASFHTIRYDFKPASIDTSCEGELQVGKGDEVTITLPHIPGSTP
PMTVFKGNKRPYQKDCVLIINHDTGEFVLEKLSSSIQVKKTRAEGSSKIQARMEQQPTRPPQTSQPPPPP
PPMPFRAPTKPPVGPKTSPLKDNPSPEPQLDDIKRELRAEVDIIEQMSSSSGSSSSDSESSSGSDDDSSS
SGGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSNQLMNALRNDLQLSESGSDSDD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_149074
RefSeq Size 4503
RefSeq ORF 804
Locus ID 85403
UniProt ID Q96JC9
Cytogenetics 3p25.1
Summary Acts as a transcriptional transactivator of ELL and ELL2 elongation activities.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EAF1" proteins (3)
SKU Description Size Price
LC409733 Lyophilized EAF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409733 Transient overexpression lysate of ELL associated factor 1 (EAF1) (as WB positive control) 100 ug
$436.00
TP307169 Purified recombinant protein of Homo sapiens ELL associated factor 1 (EAF1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products