AIFM3 (NM_001018060) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
| Product Data | |
| Tag | C-Myc/DDK |
|---|---|
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | [RC207165] |
| Predicted MW | 66 kDa |
| Protein Sequence |
Protein Sequence
>RC207165 protein sequence
Red=Cloning site Green=Tags(s) MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFHTEERLSTPHPYPSPQDCVEA AVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNISTG DLEDFPGLDSLHKFQVKIEKEKVYVRASKQALQLQRRTKVMAKCISPSAGYSSSTNVLIVGAGAAGLVCA ETLRQEGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRTKKV VFKDGFKLEYSKLLLAPGSSPKTLSCKGKEVENVFTIRTPEDANRVVRLARGRNVVVVGAGFLGMEVAAY LTEKAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKSSKVVRA DVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRKVNIPHWQMAH AQGRVAAQNMLAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKGDEVIAVAS MNYDPIVSKVAEVLASGRAIRKREVETGDMSWLTGKGS myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
| Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Shipping | Dry Ice |
| Reference Data | |
| RefSeq | NP_001018070 |
| RefSeq Size | 2354 |
| RefSeq ORF | 1794 |
| Synonyms | AIFL |
| Locus ID | 150209 |
| UniProt ID | Q96NN9 |
| Cytogenetics | 22q11.21 |
| Summary | Induces apoptosis through a caspase dependent pathway. Reduces mitochondrial membrane potential.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Write Your Own Review
| FAQs |
| SDS |
| Recombinant Protein Resources |
| SKU | Description | Size | Price | |
|---|---|---|---|---|
| LC408172 | AIFM3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
| LC422714 | AIFM3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
| LC431522 | AIFM3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
| LY408172 | Transient overexpression lysate of apoptosis-inducing factor, mitochondrion-associated, 3 (AIFM3), nuclear gene encoding mitochondrial protein, transcript variant 1 | 100 ug |
$665.00
|
|
| LY422714 | Transient overexpression lysate of apoptosis-inducing factor, mitochondrion-associated, 3 (AIFM3), nuclear gene encoding mitochondrial protein, transcript variant 2 | 100 ug |
$436.00
|
|
| LY431522 | Transient overexpression lysate of apoptosis-inducing factor, mitochondrion-associated, 3 (AIFM3), nuclear gene encoding mitochondrial protein, transcript variant 3 | 100 ug |
$436.00
|
|
| TP307165 | Recombinant protein of human apoptosis-inducing factor, mitochondrion-associated, 3 (AIFM3), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Related Products
Check items to add to the cart or
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.