PPM1K (NM_152542) Human Mass Spec Standard

SKU
PH307144
PPM1K MS Standard C13 and N15-labeled recombinant protein (NP_689755)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207144]
Predicted MW 41 kDa
Protein Sequence
Protein Sequence
>RC207144 protein sequence
Red=Cloning site Green=Tags(s)

MSTAALITLVRSGGNQVRRRVLLSSRLLQDDRRVTPTCHSSTSEPRCSRFDPDGSGSPATWDNFGIWDNR
IDEPILLPPSIKYGKPIPKISLEKVGCASQIGKRKENEDRFDFAQLTDEVLYFAVYDGHGGPAAADFCHT
HMEKCIMDLLPKEKNLETLLTLAFLEIDKAFSSHARLSADATLLTSGTTATVALLRDGIELVVASVGDSR
AILCRKGKPMKLTIDHTPERKDEKERIKKCGGFVAWNSLGQPHVNGRLAMTRSIGDLDLKTSGVIAEPET
KRIKLHHADDSFLVLTTDGINFMVNSQEICDFVNQCHDPNEAAHAVTEQAIQYGTEDNSTAVVVPFGAWG
KYKNSEINFSFSRSFASSGRWA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689755
RefSeq Size 6590
RefSeq ORF 1116
Synonyms BDP; MSUDMV; PP2Ckappa; PP2Cm; PTMP; UG0882E07
Locus ID 152926
UniProt ID Q8N3J5
Cytogenetics 4q22.1
Summary This gene encodes a member of the PPM family of Mn2+/Mg2+-dependent protein phosphatases. The encoded protein, essential for cell survival and development, is targeted to the mitochondria where it plays a key role in regulation of the mitochondrial permeability transition pore. [provided by RefSeq, Sep 2012]
Protein Families Phosphatase
Write Your Own Review
You're reviewing:PPM1K (NM_152542) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403474 PPM1K HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403474 Transient overexpression lysate of protein phosphatase 1K (PP2C domain containing) (PPM1K), nuclear gene encoding mitochondrial protein 100 ug
$436.00
TP307144 Recombinant protein of human protein phosphatase 1K (PP2C domain containing) (PPM1K), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.