Epsin 1 (EPN1) (NM_013333) Human Mass Spec Standard

SKU
PH307099
EPN1 MS Standard C13 and N15-labeled recombinant protein (NP_037465)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207099]
Predicted MW 57.3 kDa
Protein Sequence
Protein Sequence
>RC207099 representing NM_013333
Red=Cloning site Green=Tags(s)

MSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKN
WRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRL
REERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQSSGEEELQLQLALAMSKEEADQEERIRRGDD
LRLQMAIEESKRETGGKEESSLMDLADVFTAPAPAPTTDPWGGPAPMAAAVPTAAPTSDPWGGPPVPPAA
DPWGGPAPTPASGDPWRPAAPAGPSVDPWGGTPAPAAGEGPTPDPWGSSDGGVPVSGPSASDPWTPAPAF
SDPWGGSPAKPSTNGTTAGGFDTEPDEFSDFDRLRTALPTSGSSAGELELLAGEVPARSPGAFDMSGVRG
SLAEAVGSPPPAATPTPTPPTRKTPESFLGPNAALVDLDSLVSRPGPTPPGAKASNPFLPGGGPATGPSV
TNPFQPAPPATLTLNQLRLSPVPPVPGAPPTYISPLGGGPGLPPMMPPGPPAPNTNPFLL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037465
RefSeq Size 2430
RefSeq ORF 1650
Locus ID 29924
UniProt ID Q9Y6I3
Cytogenetics 19q13.42
Summary This gene encodes a member of the epsin protein family. The encoded protein binds clathrin and is involved in the endocytosis of clathrin-coated vesicles. Loss of function of this gene is associated with reduced tumor growth and progression in certain cancer types. [provided by RefSeq, Mar 2016]
Protein Pathways Endocytosis
Write Your Own Review
You're reviewing:Epsin 1 (EPN1) (NM_013333) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415639 EPN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427145 EPN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427146 EPN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415639 Transient overexpression lysate of epsin 1 (EPN1), transcript variant 3 100 ug
$436.00
LY427145 Transient overexpression lysate of epsin 1 (EPN1), transcript variant 1 100 ug
$436.00
LY427146 Transient overexpression lysate of epsin 1 (EPN1), transcript variant 2 100 ug
$436.00
TP307099 Recombinant protein of human epsin 1 (EPN1), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.