OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PDP2 (NM_020786) Human Mass Spec Standard

Be the first to review this product
SKU
PH307071
PDP2 MS Standard C13 and N15-labeled recombinant protein (NP_065837)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA379777 PDP2 Rabbit polyclonal Antibody
100 ul
$410.00
LY402805 Transient overexpression lysate of pyruvate dehyrogenase phosphatase catalytic subunit 2 (PDP2) (as WB positive control) 100 ug
$436.00

Other products for "PDP2 or NM_020786"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207071
Predicted MW 60 kDa
Protein Sequence
Protein Sequence
>RC207071 protein sequence
Red=Cloning site Green=Tags(s)

MSSTVSYWILNSTRNSIATLQGGRRLYSRYVSNRNKLKWRLFSRVPPTLNSSPCGGFTLCKAYRHTSTEE
DDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPVEDRRGVASCLQTNGLMFGIF
DGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESMKPLLPILHWLKHPGDSIYKDVTSVHLDHLR
VYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVDGIHLH
VANAGDCRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMEDRLLGVLIPCRAFGD
VQLKWSKELQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDMLSN
EDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGEMEAE
RLAAMLTLPEDLARMYRDDITVTVVYFNSESIGAYYKGG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065837
RefSeq Size 7042
RefSeq ORF 1587
Synonyms PDPC 2; PPM2B; PPM2C2
Locus ID 57546
UniProt ID Q9P2J9
Cytogenetics 16q22.1
Summary This gene is a mitochondrial protein that functions as a phosphatase and is involved in the enzymatic resetting of the pyruvate dehydrogenase complex. Alternative splicing results in multiple transcript variants encoding the same protein. provided by RefSeq, Aug 2016
Protein Families Druggable Genome, Phosphatase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PDP2" proteins (3)
SKU Description Size Price
LC402805 Lyophilized PDP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402805 Transient overexpression lysate of pyruvate dehyrogenase phosphatase catalytic subunit 2 (PDP2) (as WB positive control) 100 ug
$436.00
TP307071 Recombinant protein of human pyruvate dehydrogenase phosphatase isoenzyme 2 (PDP2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products