PDP2 (NM_020786) Human Mass Spec Standard

SKU
PH307071
PDP2 MS Standard C13 and N15-labeled recombinant protein (NP_065837)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207071]
Predicted MW 60 kDa
Protein Sequence
Protein Sequence
>RC207071 protein sequence
Red=Cloning site Green=Tags(s)

MSSTVSYWILNSTRNSIATLQGGRRLYSRYVSNRNKLKWRLFSRVPPTLNSSPCGGFTLCKAYRHTSTEE
DDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPVEDRRGVASCLQTNGLMFGIF
DGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESMKPLLPILHWLKHPGDSIYKDVTSVHLDHLR
VYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVDGIHLH
VANAGDCRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMEDRLLGVLIPCRAFGD
VQLKWSKELQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDMLSN
EDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGEMEAE
RLAAMLTLPEDLARMYRDDITVTVVYFNSESIGAYYKGG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065837
RefSeq Size 7042
RefSeq ORF 1587
Synonyms PDPC 2; PPM2B; PPM2C2
Locus ID 57546
UniProt ID Q9P2J9
Cytogenetics 16q22.1
Summary This gene is a mitochondrial protein that functions as a phosphatase and is involved in the enzymatic resetting of the pyruvate dehydrogenase complex. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Aug 2016]
Protein Families Druggable Genome, Phosphatase
Write Your Own Review
You're reviewing:PDP2 (NM_020786) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402805 PDP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402805 Transient overexpression lysate of pyruvate dehyrogenase phosphatase catalytic subunit 2 (PDP2) 100 ug
$436.00
TP307071 Recombinant protein of human pyruvate dehydrogenase phosphatase isoenzyme 2 (PDP2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.