Galanin (GAL) (NM_015973) Human Mass Spec Standard

SKU
PH307053
GAL MS Standard C13 and N15-labeled recombinant protein (NP_057057)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207053]
Predicted MW 13.3 kDa
Protein Sequence
Protein Sequence
>RC207053 protein sequence
Red=Cloning site Green=Tags(s)

MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPED
DMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057057
RefSeq Size 778
RefSeq ORF 369
Synonyms ETL8; GAL-GMAP; GALN; GLNN; GMAP
Locus ID 51083
UniProt ID P22466
Cytogenetics 11q13.2
Summary This gene encodes a neuroendocrine peptide that is widely expressed in the central and peripheral nervous systems and also the gastrointestinal tract, pancreas, adrenal gland and urogenital tract. The encoded protein is a precursor that is proteolytically processed to generate two mature peptides: galanin and galanin message-associated peptide (GMAP). Galanin has diverse physiological functions including nociception, feeding and energy homeostasis, osmotic regulation and water balance. GMAP has been demonstrated to possess antifungal activity and hypothesized to be part of the innate immune system. [provided by RefSeq, Jul 2015]
Protein Families Secreted Protein, Transmembrane
Write Your Own Review
You're reviewing:Galanin (GAL) (NM_015973) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402479 GAL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402479 Transient overexpression lysate of galanin prepropeptide (GAL) 100 ug
$436.00
TP307053 Recombinant protein of human galanin prepropeptide (GAL), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.