OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Galanin (GAL) (NM_015973) Human Mass Spec Standard

Be the first to review this product
SKU
PH307053
GAL MS Standard C13 and N15-labeled recombinant protein (NP_057057)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA371800 GAL rabbit polyclonal antibody
100 ul
$310.00
LY402479 Transient overexpression lysate of galanin prepropeptide (GAL) (as WB positive control) 100 ug
$436.00

Other products for "Galanin or NM_015973"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207053
Predicted MW 13.3 kDa
Protein Sequence
Protein Sequence
>RC207053 protein sequence
Red=Cloning site Green=Tags(s)

MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPED
DMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057057
RefSeq Size 778
RefSeq ORF 369
Synonyms ETL8; GAL-GMAP; GALN; GLNN; GMAP
Locus ID 51083
UniProt ID P22466
Cytogenetics 11q13.2
Summary This gene encodes a neuroendocrine peptide that is widely expressed in the central and peripheral nervous systems and also the gastrointestinal tract, pancreas, adrenal gland and urogenital tract. The encoded protein is a precursor that is proteolytically processed to generate two mature peptides: galanin and galanin message-associated peptide (GMAP). Galanin has diverse physiological functions including nociception, feeding and energy homeostasis, osmotic regulation and water balance. GMAP has been demonstrated to possess antifungal activity and hypothesized to be part of the innate immune system. provided by RefSeq, Jul 2015
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Galanin" proteins (3)
SKU Description Size Price
LC402479 Lyophilized GAL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402479 Transient overexpression lysate of galanin prepropeptide (GAL) (as WB positive control) 100 ug
$436.00
TP307053 Recombinant protein of human galanin prepropeptide (GAL), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products