CNPase (CNP) (NM_033133) Human Mass Spec Standard

SKU
PH307038
CNP MS Standard C13 and N15-labeled recombinant protein (NP_149124)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207038]
Predicted MW 47.6 kDa
Protein Sequence
Protein Sequence
>RC207038 protein sequence
Red=Cloning site Green=Tags(s)

MNRGFSRKSHTFLPKIFFRKMSSSGAKDKPELQFPFLQDEDTVATLLECKTLFILRGLPGSGKSTLARVI
VDKYRDGTKMVSADAYKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLFEMADQ
YQYQVVLVEPKTAWRLDCAQLKEKNQWQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFL
EELGNHKAFKKELRQFVPGDEPREKMDLVTYFGKRPPGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSK
AFTLTISALFVTPKTTGARVELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITLGCAADVEAVQTGLDLLE
ILRQEKGGSRGEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTI
I

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_149124
RefSeq Size 5222
RefSeq ORF 1263
Synonyms CNP1
Locus ID 1267
UniProt ID P09543
Cytogenetics 17q21.2
Summary May participate in RNA metabolism in the myelinating cell, CNP is the third most abundant protein in central nervous system myelin.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:CNPase (CNP) (NM_033133) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409699 CNP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409699 Transient overexpression lysate of 2',3'-cyclic nucleotide 3' phosphodiesterase (CNP) 100 ug
$436.00
TP307038 Recombinant protein of human 2',3'-cyclic nucleotide 3' phosphodiesterase (CNP), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.