Alpha SNAP (NAPA) (NM_003827) Human Mass Spec Standard
CAT#: PH307037
NAPA MS Standard C13 and N15-labeled recombinant protein (NP_003818)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207037 |
Predicted MW | 33.2 kDa |
Protein Sequence |
>RC207037 protein sequence
Red=Cloning site Green=Tags(s) MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSAAGNAFCQAAQ LHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIAAKHHISIAEIYETELVDIEK AIAHYEQSADYYKGEESNSSANKCLLKVAGYAALLEQYQKAIDIYEQVGTNAMDSPLLKYSAKDYFFKAA LCHFCIDMLNAKLAVQKYEELFPAFSDSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTML LRIKKTIQGDEEDLR SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003818 |
RefSeq Size | 1865 |
RefSeq ORF | 885 |
Synonyms | SNAPA |
Locus ID | 8775 |
UniProt ID | P54920, A0A024R0R9 |
Cytogenetics | 19q13.32-q13.33 |
Summary | This gene encodes a member of the soluble NSF attachment protein (SNAP) family. SNAP proteins play a critical role in the docking and fusion of vesicles to target membranes as part of the 20S NSF-SNAP-SNARE complex. The encoded protein plays a role in the completion of membrane fusion by mediating the interaction of N-ethylmaleimide-sensitive factor (NSF) with the vesicle-associated and membrane-associated SNAP receptor (SNARE) complex, and stimulating the ATPase activity of NSF. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jun 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401256 | NAPA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401256 | Transient overexpression lysate of N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA) |
USD 436.00 |
|
TP307037 | Recombinant protein of human N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA), 20 µg |
USD 867.00 |
|
TP720247 | Recombinant protein of human N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review