Alpha SNAP (NAPA) (NM_003827) Human Mass Spec Standard

SKU
PH307037
NAPA MS Standard C13 and N15-labeled recombinant protein (NP_003818)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207037]
Predicted MW 33.2 kDa
Protein Sequence
Protein Sequence
>RC207037 protein sequence
Red=Cloning site Green=Tags(s)

MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSAAGNAFCQAAQ
LHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIAAKHHISIAEIYETELVDIEK
AIAHYEQSADYYKGEESNSSANKCLLKVAGYAALLEQYQKAIDIYEQVGTNAMDSPLLKYSAKDYFFKAA
LCHFCIDMLNAKLAVQKYEELFPAFSDSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTML
LRIKKTIQGDEEDLR

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003818
RefSeq Size 1865
RefSeq ORF 885
Synonyms SNAPA
Locus ID 8775
UniProt ID P54920
Cytogenetics 19q13.32-q13.33
Summary This gene encodes a member of the soluble NSF attachment protein (SNAP) family. SNAP proteins play a critical role in the docking and fusion of vesicles to target membranes as part of the 20S NSF-SNAP-SNARE complex. The encoded protein plays a role in the completion of membrane fusion by mediating the interaction of N-ethylmaleimide-sensitive factor (NSF) with the vesicle-associated and membrane-associated SNAP receptor (SNARE) complex, and stimulating the ATPase activity of NSF. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jun 2011]
Write Your Own Review
You're reviewing:Alpha SNAP (NAPA) (NM_003827) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401256 NAPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401256 Transient overexpression lysate of N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA) 100 ug
$436.00
TP307037 Recombinant protein of human N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720247 Recombinant protein of human N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.