Neurogenin 1 (NEUROG1) (NM_006161) Human Mass Spec Standard

SKU
PH307029
NEUROG1 MS Standard C13 and N15-labeled recombinant protein (NP_006152)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207029]
Predicted MW 25.7 kDa
Protein Sequence
Protein Sequence
>RC207029 protein sequence
Red=Cloning site Green=Tags(s)

MPARLETCISDLDCASSSGSDLSGFLTDEEDCARLQQAASASGPPAPARRGAPNISRASEVPGAQDDEQE
RRRRRGRTRVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLPSFPDDTKLTKIETLRFAYNY
IWALAETLRLADQGLPGGGARERLLPPQCVPCLPGPPSPASDAESWGSGAAAASPLSDPSSPAASEDFTY
RPGDPVFSFPSLPKDLLHTTPCFIPYH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006152
RefSeq Size 1717
RefSeq ORF 711
Synonyms AKA; bHLHa6; Math4C; NEUROD3; ngn1
Locus ID 4762
UniProt ID Q92886
Cytogenetics 5q31.1
Summary Acts as a transcriptional regulator. Involved in the initiation of neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3'). Associates with chromatin to enhancer regulatory elements in genes encoding key transcriptional regulators of neurogenesis (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
Write Your Own Review
You're reviewing:Neurogenin 1 (NEUROG1) (NM_006161) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401855 NEUROG1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401855 Transient overexpression lysate of neurogenin 1 (NEUROG1) 100 ug
$436.00
TP307029 Recombinant protein of human neurogenin 1 (NEUROG1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.