C7orf16 (PPP1R17) (NM_006658) Human Mass Spec Standard

SKU PH307007

C7orf16 MS Standard C13 and N15-labeled recombinant protein (NP_006649)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC207007]
• Predicted MW: 17.9 kDa
• Protein Sequence:
  Protein Sequence

  >RC207007 protein sequence; Red=Cloning site Green=Tags(s); ; MMSTEQMQPLEVSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPA; LHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMSPFAAGVTLLRDERPK; AIVEDDEKDGDKIAI; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_006649
• RefSeq Size: 1966
• RefSeq ORF: 465
• Synonyms: C7orf16; GSBS
• Locus ID: 10842
• UniProt ID: O96001
• Cytogenetics: 7p14.3
• Summary: The protein encoded by this gene is found primarily in cerebellar Purkinje cells, where it functions as a protein phosphatase inhibitor. The encoded protein is a substrate for cGMP-dependent protein kinase. An allele of this gene was discovered that increases susceptibility to hypercholesterolemia. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010]
• Protein Pathways: Long-term depression