LILRA3 (NM_006865) Human Mass Spec Standard

SKU
PH307003
LILRA3 MS Standard C13 and N15-labeled recombinant protein (NP_006856)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207003]
Predicted MW 47.5 kDa
Protein Sequence
Protein Sequence
>RC207003 protein sequence
Red=Cloning site Green=Tags(s)

MTSILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWI
TRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTVGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGN
VTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSL
PSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQA
NFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQG
GMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVS
GAAETLSPPQNKSDSKAGE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006856
RefSeq Size 1608
RefSeq ORF 1317
Synonyms CD85E; HM31; HM43; ILT-6; ILT6; LIR-4; LIR4
Locus ID 11026
UniProt ID Q8N6C8
Cytogenetics 19q13.4
Summary This gene encodes a member of a family of immunoreceptors that are expressed predominantly in monocytes and B cells, and at lower levels in dendritic cells and natural killer cells. The encoded protein lacks the transmembrane region found in other members of this family. It acts as a soluble receptor for class I major histocompatibility complex (MHC) antigens. Alternatively spliced transcript variants encoding different isoforms have been found. This gene is located in a cluster of related genes on chromosome 19 and is polymorphic in human populations, with many individuals containing a deletion of this genomic region. [provided by RefSeq, Mar 2014]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:LILRA3 (NM_006865) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416372 LILRA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432960 LILRA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416372 Transient overexpression lysate of leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3 (LILRA3) 100 ug
$436.00
LY432960 Transient overexpression lysate of leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3 (LILRA3), transcript variant 2 100 ug
$436.00
TP307003 Recombinant protein of human leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3 (LILRA3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP721110 Purified recombinant protein of Human leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3 (LILRA3), transcript variant 1 10 ug
$250.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.