OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

APOBEC3G (NM_021822) Human Mass Spec Standard

Be the first to review this product
SKU
PH306821
APOBEC3G MS Standard C13 and N15-labeled recombinant protein (NP_068594)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349489 Rabbit Polyclonal Anti-APOBEC3G Antibody
100 ul
$205.00
LY411904 Transient overexpression lysate of apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G (APOBEC3G) (as WB positive control) 100 ug
$436.00

Other products for "APOBEC3G or NM_021822"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206821
Predicted MW 46.4 kDa
Protein Sequence
Protein Sequence
>RC206821 protein sequence
Red=Cloning site Green=Tags(s)

MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPPLDAKIFRGQVYSELKYHPEMRF
FHWFSKWRKLHRDQEYEVTWYISWSPCTKCTRDMATFLAEDPKVTLTIFVARLYYFWDPDYQEALRSLCQ
KRDGPRATMKIMNYDEFQHCWSKFVYSQRELFEPWNNLPKYYILLHIMLGEILRHSMDPPTFTFNFNNEP
WVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVT
CFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTF
VDHQGCPFQPWDGLDEHSQDLSGRLRAILQNQEN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_068594
RefSeq Size 1848
RefSeq ORF 1152
Synonyms A3G; ARCD; ARP-9; ARP9; bK150C2.7; CEM-15; CEM15; dJ494G10.1; MDS019
Locus ID 60489
UniProt ID Q9HC16
Cytogenetics 22q13.1
Summary This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. The protein encoded by this gene catalyzes site-specific deamination of both RNA and single-stranded DNA. The encoded protein has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity. provided by RefSeq, Mar 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "APOBEC3G" proteins (3)
SKU Description Size Price
LC411904 Lyophilized APOBEC3G HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411904 Transient overexpression lysate of apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G (APOBEC3G) (as WB positive control) 100 ug
$436.00
TP306821 Recombinant protein of human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G (APOBEC3G), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products