CAMKIV (CAMK4) (NM_001744) Human Mass Spec Standard

SKU
PH306813
CAMK4 MS Standard C13 and N15-labeled recombinant protein (NP_001735)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206813]
Predicted MW 51.9 kDa
Protein Sequence
Protein Sequence
>RC206813 protein sequence
Red=Cloning site Green=Tags(s)

MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIVYRCKQKGTQK
PYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERD
AADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAP
EILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKL
IVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQ
ESHKASRDPSPIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKA
VEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001735
RefSeq Size 2272
RefSeq ORF 1419
Synonyms caMK; CaMK-GR; CaMK IV; CaMKIV
Locus ID 814
UniProt ID Q16566
Cytogenetics 5q22.1
Summary The product of this gene belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This enzyme is a multifunctional serine/threonine protein kinase with limited tissue distribution, that has been implicated in transcriptional regulation in lymphocytes, neurons and male germ cells. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Calcium signaling pathway, Long-term potentiation, Neurotrophin signaling pathway
Write Your Own Review
You're reviewing:CAMKIV (CAMK4) (NM_001744) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400661 CAMK4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400661 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase IV (CAMK4) 100 ug
$436.00
TP306813 Recombinant protein of human calcium/calmodulin-dependent protein kinase IV (CAMK4), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.