Plzf (ZBTB16) (NM_006006) Human Mass Spec Standard

SKU
PH306745
ZBTB16 MS Standard C13 and N15-labeled recombinant protein (NP_005997)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206745]
Predicted MW 74.1 kDa
Protein Sequence
Protein Sequence
>RC206745 representing NM_006006
Red=Cloning site Green=Tags(s)

MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFEILFHRNSQHY
TLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADG
GAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSAMSPTKAAVDSLMTIG
QSLLQGTLQPPAGPEEPTLAGGGRHPGVAEVKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGP
GTPTRSSVITSARELHYGREESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPS
SVTSGLHVQPALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHRQTHTGTDMAV
FCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSHTGDHPYECEFCGSCFRDEST
LKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEKPFECKLCHQRSRDYSAMIKHLRTHNGASPY
QCTICTEYCPSLSSMQKHMKGHKPEEIPPDWRIEKTYLYLCYV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005997
RefSeq Size 2417
RefSeq ORF 2019
Synonyms PLZF; ZNF145
Locus ID 7704
UniProt ID Q05516
Cytogenetics 11q23.2
Summary This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Acute myeloid leukemia, Pathways in cancer
Write Your Own Review
You're reviewing:Plzf (ZBTB16) (NM_006006) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416930 ZBTB16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422693 ZBTB16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416930 Transient overexpression lysate of zinc finger and BTB domain containing 16 (ZBTB16), transcript variant 1 100 ug
$436.00
LY422693 Transient overexpression lysate of zinc finger and BTB domain containing 16 (ZBTB16), transcript variant 2 100 ug
$665.00
TP306745 Recombinant protein of human zinc finger and BTB domain containing 16 (ZBTB16), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.