IGSF11 (NM_152538) Human Mass Spec Standard

SKU
PH306735
IGSF11 MS Standard C13 and N15-labeled recombinant protein (NP_689751)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206735]
Predicted MW 46.2 kDa
Protein Sequence
Protein Sequence
>RC206735 protein sequence
Red=Cloning site Green=Tags(s)

MSLVELLLWWNCFSRTGVAASLEVSESPGSIQVARGQTAVLPCTFTTSAALINLNVIWMVTPLSNANQPE
QVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVL
VPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSG
LYQCVASNAIGTSTCLLDLQVISPQPRNIGLIAGAIGTGAVIIIFCIALILGAFFYWRSKNKEEEEEEIP
NEIREDDLPPKCSSAKAFHTEISSSDNNTLTSSNAYNSRYWSNNPKVHRNTESVSHFSDLGQSFSFHSGN
ANIPSIYANGTHLVPGQHKTLVVTANRGSSPQVMSRSNGSVSRKPRPPHTHSYTISHATLERIGAVPVMV
PAQSRAGSLV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689751
RefSeq Size 3577
RefSeq ORF 1290
Synonyms BT-IgSF; CT119; CXADRL1; Igsf13; VSIG3
Locus ID 152404
UniProt ID Q5DX21
Cytogenetics 3q13.32
Summary IGSF11 is an immunoglobulin (Ig) superfamily member that is preferentially expressed in brain and testis. It shares significant homology with coxsackievirus and adenovirus receptor (CXADR; MIM 602621) and endothelial cell-selective adhesion molecule (ESAM).[supplied by OMIM, Apr 2005]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:IGSF11 (NM_152538) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407451 IGSF11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407451 Transient overexpression lysate of immunoglobulin superfamily, member 11 (IGSF11), transcript variant 1 100 ug
$436.00
TP306735 Recombinant protein of human immunoglobulin superfamily, member 11 (IGSF11), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.