OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ARH (LDLRAP1) (NM_015627) Human Mass Spec Standard

Be the first to review this product
SKU
PH306643
LDLRAP1 MS Standard C13 and N15-labeled recombinant protein (NP_056442)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA503854 LDLRAP1 (ARH) mouse monoclonal antibody, clone OTI7E11 (formerly 7E11) 100 ul
$447.00
LY414462 Transient overexpression lysate of low density lipoprotein receptor adaptor protein 1 (LDLRAP1) (as WB positive control) 100 ug
$436.00

Other products for "ARH or NM_015627"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206643
Predicted MW 33.7 kDa
Protein Sequence
Protein Sequence
>RC206643 representing NM_015627
Red=Cloning site Green=Tags(s)

MDALKSAGRALIRSPSLAKQSWGGGGRHRKLPENWTDTRETLLEGMLFSLKYLGMTLVEQPKGEELSAAA
IKRIVATAKASGKKLQKVTLKVSPRGIILTDNLTNQLIENVSIYRISYCTADKMHDKVFAYIAQSQHNQS
LECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPPLKSLVATG
NLLDLEETAKAPLSTVSANTTNMDEVPRPQALSGSSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLTAQD
MHYAQCLSPVDWDKPDSSGTEQDDLFSF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056442
RefSeq Size 2862
RefSeq ORF 924
Synonyms ARH; ARH1; ARH2; FHCB1; FHCB2; FHCL4
Locus ID 26119
UniProt ID Q5SW96
Cytogenetics 1p36.11
Summary The protein encoded by this gene is a cytosolic protein which contains a phosphotyrosine binding (PTD) domain. The PTD domain has been found to interact with the cytoplasmic tail of the LDL receptor. Mutations in this gene lead to LDL receptor malfunction and cause the disorder autosomal recessive hypercholesterolaemia. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Endocytosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ARH" proteins (3)
SKU Description Size Price
LC414462 Lyophilized LDLRAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414462 Transient overexpression lysate of low density lipoprotein receptor adaptor protein 1 (LDLRAP1) (as WB positive control) 100 ug
$436.00
TP306643 Recombinant protein of human low density lipoprotein receptor adaptor protein 1 (LDLRAP1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products