ARH (LDLRAP1) (NM_015627) Human Mass Spec Standard

SKU
PH306643
LDLRAP1 MS Standard C13 and N15-labeled recombinant protein (NP_056442)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206643]
Predicted MW 33.7 kDa
Protein Sequence
Protein Sequence
>RC206643 representing NM_015627
Red=Cloning site Green=Tags(s)

MDALKSAGRALIRSPSLAKQSWGGGGRHRKLPENWTDTRETLLEGMLFSLKYLGMTLVEQPKGEELSAAA
IKRIVATAKASGKKLQKVTLKVSPRGIILTDNLTNQLIENVSIYRISYCTADKMHDKVFAYIAQSQHNQS
LECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPPLKSLVATG
NLLDLEETAKAPLSTVSANTTNMDEVPRPQALSGSSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLTAQD
MHYAQCLSPVDWDKPDSSGTEQDDLFSF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056442
RefSeq Size 2862
RefSeq ORF 924
Synonyms ARH; ARH1; ARH2; FHCB1; FHCB2; FHCL4
Locus ID 26119
UniProt ID Q5SW96
Cytogenetics 1p36.11
Summary The protein encoded by this gene is a cytosolic protein which contains a phosphotyrosine binding (PTD) domain. The PTD domain has been found to interact with the cytoplasmic tail of the LDL receptor. Mutations in this gene lead to LDL receptor malfunction and cause the disorder autosomal recessive hypercholesterolaemia. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Endocytosis
Write Your Own Review
You're reviewing:ARH (LDLRAP1) (NM_015627) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414462 LDLRAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414462 Transient overexpression lysate of low density lipoprotein receptor adaptor protein 1 (LDLRAP1) 100 ug
$436.00
TP306643 Recombinant protein of human low density lipoprotein receptor adaptor protein 1 (LDLRAP1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.