Clavesin 1 (CLVS1) (NM_173519) Human Mass Spec Standard

SKU
PH306628
CLVS1 MS Standard C13 and N15-labeled recombinant protein (NP_775790)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206628]
Predicted MW 40.8 kDa
Protein Sequence
Protein Sequence
>RC206628 protein sequence
Red=Cloning site Green=Tags(s)

MGPVSLLPKYQKLNTWNGDLAKMTHLQAGLSPETIEKARLELNENPDVLHQDIQQVRDMIITRPDIGFLR
TDDAFILRFLRARKFHQADAFRLLAQYFQYRQLNLDMFKNFKADDPGIKRALIDGFPGVLENRDHYGRKI
LLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGFILIIDWSNFSFKQASKLTPSILKLAIEGLQ
DSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFGGTLPPYDM
GTWARTLLGPDYSDENDYTHTSYNAMHVKHTSSNLERECSPKLMKRSQSVVEAGTLKHEEKGENENTQPL
LALD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_775790
RefSeq Size 3506
RefSeq ORF 1062
Synonyms C6orf212L; CRALBPL; RLBP1L1
Locus ID 157807
UniProt ID Q8IUQ0
Cytogenetics 8q12.2-q12.3
Summary Required for normal morphology of late endosomes and/or lysosomes in neurons (By similarity). Binds phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Clavesin 1 (CLVS1) (NM_173519) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406451 CLVS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406451 Transient overexpression lysate of clavesin 1 (CLVS1) 100 ug
$436.00
TP306628 Recombinant protein of human retinaldehyde binding protein 1-like 1 (RLBP1L1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.