MPPED2 (NM_001584) Human Mass Spec Standard

SKU
PH306617
MPPED2 MS Standard C13 and N15-labeled recombinant protein (NP_001575)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206617]
Predicted MW 33.4 kDa
Protein Sequence
Protein Sequence
>RC206617 protein sequence
Red=Cloning site Green=Tags(s)

MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRT
DGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPS
VSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDIL
MTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPT
NPPIIFDLPNPQGS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001575
RefSeq Size 2404
RefSeq ORF 882
Synonyms 239FB; C11orf8
Locus ID 744
UniProt ID Q15777
Cytogenetics 11p14.1
Summary This gene likely encodes a metallophosphoesterase. The encoded protein may play a role a brain development. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2009]
Write Your Own Review
You're reviewing:MPPED2 (NM_001584) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419851 MPPED2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419851 Transient overexpression lysate of metallophosphoesterase domain containing 2 (MPPED2), transcript variant 1 100 ug
$436.00
TP306617 Recombinant protein of human metallophosphoesterase domain containing 2 (MPPED2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.