CD2 (NM_001767) Human Mass Spec Standard

SKU
PH306612
CD2 MS Standard C13 and N15-labeled recombinant protein (NP_001758)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206612]
Predicted MW 39.4 kDa
Protein Sequence
Protein Sequence
>RC206612 protein sequence
Red=Cloning site Green=Tags(s)

MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQ
FRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQERVSKPKISWTCI
NTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSLSAKFKCTAGNKVSKESSVEPVSCPEKGLDI
YLIIGICGGGSLLMVFVALLVFYITKRKKQRSRRNDEELETRAHRVATEERGRKPQQIPASTPQNPATSQ
HPPPPPGHRSQAPSHRPPPPGHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSS
N

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001758
RefSeq Size 1595
RefSeq ORF 1053
Synonyms LFA-2; SRBC; T11
Locus ID 914
UniProt ID P06729
Cytogenetics 1p13.1
Summary The protein encoded by this gene is a surface antigen found on all peripheral blood T-cells. The encoded protein interacts with LFA3 (CD58) on antigen presenting cells to optimize immune recognition. A locus control region (LCR) has been found in the 3' flanking sequence of this gene. [provided by RefSeq, Jun 2016]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Hematopoietic cell lineage
Write Your Own Review
You're reviewing:CD2 (NM_001767) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400671 CD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400671 Transient overexpression lysate of CD2 molecule (CD2) 100 ug
$436.00
TP306612 Purified recombinant protein of Homo sapiens CD2 molecule (CD2), 20 µg 20 ug
$737.00
TP700239 Purified recombinant protein of human CD2 molecule (CD2), with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$867.00
TP721123 Purified recombinant protein of Human CD2 molecule (CD2) 10 ug
$330.00
TP761130 Purified recombinant protein of Human CD2 molecule (CD2), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.