Myosin (MYL4) (NM_001002841) Human Mass Spec Standard

SKU
PH306569
MYL4 MS Standard C13 and N15-labeled recombinant protein (NP_001002841)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206569]
Predicted MW 21.6 kDa
Protein Sequence
Protein Sequence
>RC206569 protein sequence
Red=Cloning site Green=Tags(s)

MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGE
MKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLR
VFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001002841
RefSeq Size 934
RefSeq ORF 591
Synonyms ALC1; AMLC; GT1; PRO1957
Locus ID 4635
UniProt ID P12829
Cytogenetics 17q21.32
Summary Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Myosin (MYL4) (NM_001002841) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH313170 MYL4 MS Standard C13 and N15-labeled recombinant protein (NP_002467) 10 ug
$3,255.00
LC419311 MYL4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424166 MYL4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425089 MYL4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419311 Transient overexpression lysate of myosin, light chain 4, alkali; atrial, embryonic (MYL4), transcript variant 2 100 ug
$436.00
LY424166 Transient overexpression lysate of myosin, light chain 4, alkali; atrial, embryonic (MYL4), transcript variant 1 100 ug
$436.00
TP306569 Recombinant protein of human myosin, light chain 4, alkali; atrial, embryonic (MYL4), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP313170 Recombinant protein of human myosin, light chain 4, alkali; atrial, embryonic (MYL4), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.