Apolipoprotein CIII (APOC3) (NM_000040) Human Mass Spec Standard

SKU PH306566

APOC3 MS Standard C13 and N15-labeled recombinant protein (NP_000031)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC206566]
• Predicted MW: 10.9 kDa
• Protein Sequence:
  Protein Sequence

  >RC206566 protein sequence; Red=Cloning site Green=Tags(s); ; MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSL; KDYWSTVKDKFSEFWDLDPEVRPTSAVAA; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_000031
• RefSeq Size: 533
• RefSeq ORF: 297
• Synonyms: APOCIII
• Locus ID: 345
• UniProt ID: P02656
• Cytogenetics: 11q23.3
• Summary: This gene encodes a protein component of triglyceride (TG)-rich lipoproteins (TRLs) including very low density lipoproteins (VLDL), high density lipoproteins (HDL) and chylomicrons. The encoded protein plays a role in role in the metabolism of these TRLs through multiple modes. This protein has been shown to promote the secretion of VLDL1, inhibit lipoprotein lipase enzyme activity, and delay catabolism of TRL remnants. Mutations in this gene are associated with low plasma triglyceride levels and reduced risk of ischemic cardiovascular disease, and hyperalphalipoproteinemia, which is characterized by elevated levels of high density lipoprotein (HDL) and HDL cholesterol in human patients. This gene and other related genes comprise an apolipoprotein gene cluster on chromosome 11. [provided by RefSeq, Sep 2017]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: PPAR signaling pathway