OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HSD17B3 (NM_000197) Human Mass Spec Standard

Be the first to review this product
SKU
PH306558
HSD17B3 MS Standard C13 and N15-labeled recombinant protein (NP_000188)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811500 HSD17B3 mouse monoclonal antibody,clone OTI7F7 100 ul
$447.00
LY424871 Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 3 (HSD17B3) (as WB positive control) 100 ug
$436.00

Other products for "HSD17B3 or NM_000197"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206558
Predicted MW 34.5 kDa
Protein Sequence
Protein Sequence
>RC206558 protein sequence
Red=Cloning site Green=Tags(s)

MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAK
RGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKLAGLEIGILVNNVGMLPNLLP
SHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLILNISSGIALFPWPLYSMYSASKAFVCAFSK
ALQEEYKAKEVIIQVLTPYAVSTAMTKYLNTNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSL
IPAWAFYSGAFQRLLLTHYVAYLKLNTKVR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000188
RefSeq Size 1134
RefSeq ORF 930
Synonyms EDH17B3; SDR12C2
Locus ID 3293
UniProt ID P37058
Cytogenetics 9q22.32
Summary This isoform of 17 beta-hydroxysteroid dehydrogenase is expressed predominantly in the testis and catalyzes the conversion of androstenedione to testosterone. It preferentially uses NADP as cofactor. Deficiency can result in male pseudohermaphroditism with gynecomastia. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transmembrane
Protein Pathways Androgen and estrogen metabolism, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HSD17B3" proteins (3)
SKU Description Size Price
LC424871 Lyophilized HSD17B3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY424871 Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 3 (HSD17B3) (as WB positive control) 100 ug
$436.00
TP306558 Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 3 (HSD17B3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products